PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G16930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 1100aa    MW: 121518 Da    PI: 6.0074
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G16930.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.1e-16682729148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+ Ed +l  ++k++G ++Wk++ +  g+ R++k+c++rw ++l
  LPERR05G16930.1 682 KGPWTPSEDAILEAYIKKHGERNWKSVQKNTGLLRCGKSCRLRWMNHL 729
                      79******************************99************96 PP

2Myb_DNA-binding422.2e-13735778146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE+ ++++++ ++G++ W+  ++ ++ gRt++++k++w++
  LPERR05G16930.1 735 KGAFSKEEENKIIRLHYKMGNK-WAQMSAQLP-GRTDNEIKNYWNT 778
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS51575197.04138673IPR025794Histone H3-K9 methyltransferase, plant
SuperFamilySSF886977.95E-58173358IPR015947PUA-like domain
SMARTSM004664.0E-76186342IPR003105SRA-YDG
PfamPF021821.0E-45190342IPR003105SRA-YDG
PROSITE profilePS5101556.444191338IPR003105SRA-YDG
Gene3DG3DSA:2.30.280.102.2E-52202368IPR003105SRA-YDG
SuperFamilySSF821991.05E-74352622No hitNo description
SMARTSM004682.4E-26367461IPR007728Pre-SET domain
Gene3DG3DSA:2.170.270.101.1E-67369626No hitNo description
PfamPF050332.8E-17371469IPR007728Pre-SET domain
PROSITE profilePS5086711.109413474IPR007728Pre-SET domain
SMARTSM003173.2E-39477627IPR001214SET domain
PROSITE profilePS5028019.632477621IPR001214SET domain
PfamPF008562.6E-23488621IPR001214SET domain
PROSITE profilePS5129424.916677733IPR017930Myb domain
SuperFamilySSF466891.17E-27680776IPR009057Homeodomain-like
SMARTSM007173.6E-15681731IPR001005SANT/Myb domain
PfamPF002491.3E-14682729IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-23683736IPR009057Homeodomain-like
CDDcd001677.26E-12684729No hitNo description
PROSITE profilePS5129417.041734784IPR017930Myb domain
SMARTSM007172.1E-14734782IPR001005SANT/Myb domain
PfamPF002491.2E-12735778IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-24737782IPR009057Homeodomain-like
CDDcd001676.50E-10737778No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0034968Biological Processhistone lysine methylation
GO:0005634Cellular Componentnucleus
GO:0005694Cellular Componentchromosome
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0018024Molecular Functionhistone-lysine N-methyltransferase activity
GO:0042393Molecular Functionhistone binding
Sequence ? help Back to Top
Protein Sequence    Length: 1100 aa     Download sequence    Send to blast
MGVNVSQSST PPLVCVTPVG QFPVGFGSGN LPAFGSTTTF TTTANGVSHA GTSANGPIDA  60
TPISAYKTRP GIVSLDDDNE PYSGTPNSKP KRGRPRKNSS GSTADGSNGV RFKRPKPVYK  120
NFVAGKELAF LPPASSDPRV IVETVHMTFE ALRRRHLQLD EIQEASKRAD LKAGAIMMAS  180
NIRANVGKRV GTVPGVEIGD IFYFRMELCI IGLHAPSMGG IDYMSAKFGT DEDSVAICIV  240
AAGGYENEDD DTDTLVYSGQ GGNSKNSEER QDQKLERGNL ALERSLHRKN EIRVVRGFRD  300
PFCLTGKIYI YDGLYKINES WKERTKSGIN CFKYKLLREP GQPDGAALWK MTQEWVDNPA  360
SRGRVILPDL SSGAEVLPVC LVNEVDHEKG PGHFTYASQV KYLRPLSSMK SLQGCECQSV  420
CLPGDVNCAC GQHNGGDLPY SSSGLLVCRK PIIYECGEAC HCSTNCRNRV TQKGVRFHFE  480
VFRTENRGWG LRCWDPIRAG AFICEYTGEV IDELKVNLDD SEDDYIFQTV CPGEKTLKWN  540
FGSELIGEES TYVSADEFEP LPIKISAKKM GNASRFMNHS CSPNVFWQPV QHDHGDDSHP  600
HIMFFALKHI PPMTELTYDY GVAGSETHGS GSMHACGNES DLVSDKMNWS TDNDGDGDSS  660
MDKHSSSGGT KPGGAVSPVL KKGPWTPSED AILEAYIKKH GERNWKSVQK NTGLLRCGKS  720
CRLRWMNHLR PDLKKGAFSK EEENKIIRLH YKMGNKWAQM SAQLPGRTDN EIKNYWNTRI  780
KKCKNILSLL YPADVCQQAL DEDQHESSDF GFREKLTNDS LYAPGFTCDK FNSHPQFSDA  840
SIKNILGQRF VDFASTFEIP LPPLNRTDNG IFPSANFLAN HGFTNDHFPT SRSITGPMKL  900
GLPSIQFAES HPDSWSMYPR TSATQLTNFA DVFMNSTSSP THSSHVAPKS SDQSEELLHE  960
VHPLNYVVKE ELYSGSLNPI VGVPCDAVTE PSEIDPCDEY REQDNDFYTL VESGFCAPSL  1020
FPSSLGNLQN SELSSAQTLI AGSNELLLPH YQGDASLLQE GFMPNTHYFN DINPSIFEGT  1080
DDLCMENIVD TKGHRLPDMS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4nj5_A1e-1061326236507Probable histone-lysine N-methyltransferase,
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1297180.0AC129718.2 Oryza sativa Japonica Group cultivar Nipponbare chromosome 5 clone OSJNBa0088I06, complete sequence.
GenBankAK0690350.0AK069035.1 Oryza sativa Japonica Group cDNA clone:J023004N15, full insert sequence.
GenBankAP0149610.0AP014961.1 Oryza sativa Japonica Group DNA, chromosome 5, cultivar: Nipponbare, complete sequence.
GenBankCP0126130.0CP012613.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654577.10.0PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1-like
TrEMBLA0A0D9WI030.0A0A0D9WI03_9ORYZ; Uncharacterized protein
STRINGOB05G28580.10.0(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.11e-52myb domain protein 101